PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI11G13390.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 330aa    MW: 35990.2 Da    PI: 6.9112
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI11G13390.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.56.6e-181562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++q+G+g+W+++++  g+ R+ k+c++rw +yl
  OMERI11G13390.1 15 KGPWTPEEDIILVSYIQQHGPGNWRSVPENTGLMRCSKSCRLRWTNYL 62
                     79********************************************97 PP

2Myb_DNA-binding47.15.4e-1568113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E+ +++++ ++lG++ W++Ia++++  Rt++++k++w+++l
  OMERI11G13390.1  68 RGNFTPHEEGIIIHLQALLGNK-WAAIASYLP-QRTDNDIKNYWNTHL 113
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.6421066IPR017930Myb domain
SuperFamilySSF466891.67E-3012109IPR009057Homeodomain-like
SMARTSM007177.4E-141464IPR001005SANT/Myb domain
PfamPF002492.8E-161562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-231669IPR009057Homeodomain-like
CDDcd001672.29E-121762No hitNo description
PROSITE profilePS5129419.14867117IPR017930Myb domain
SMARTSM007172.4E-1367115IPR001005SANT/Myb domain
PfamPF002492.9E-1368113IPR001005SANT/Myb domain
CDDcd001677.12E-1070113No hitNo description
Gene3DG3DSA:1.10.10.601.5E-2470117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MGRPPCCDNG VGVKKGPWTP EEDIILVSYI QQHGPGNWRS VPENTGLMRC SKSCRLRWTN  60
YLRPGIKRGN FTPHEEGIII HLQALLGNKW AAIASYLPQR TDNDIKNYWN THLKKKVKRL  120
QQQQQSHPDH HHHHSFQTTP SSSNAAAVAT ASPNYYNPNN SNSNSSNHLH NNNHNLESMQ  180
SMASAPSNEA TTIPKLFQFQ TWMKPSPATT SSAATAAAGS CYKQAMAMQE LQEEQEGSAA  240
AAAMASSIDG VSKDQNYHMC AVISGDDKSS SSEMMTAAAM AGHGEAATTT FSLLENWLLD  300
DMPGQAAMSA AMDGFLEISA GYCCADPIMF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C1e-25151174105C-Myb DNA-Binding Domain
1mse_C1e-25151174105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1108440.0AK110844.1 Oryza sativa Japonica Group cDNA clone:002-172-B09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618031.10.0PREDICTED: transcription factor MYB30
TrEMBLA0A0E0F6J20.0A0A0E0F6J2_9ORYZ; Uncharacterized protein
STRINGBGIOSGA033804-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os11g35390.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.12e-79myb domain protein 60